Lineage for d1hxmf1 (1hxm F:1-123)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105447Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1105524Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (3 PDB entries)
  8. 1105529Domain d1hxmf1: 1hxm F:1-123 [61377]
    Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2
    complexed with so4

Details for d1hxmf1

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor
PDB Compounds: (F:) gamma-delta T-cell receptor

SCOPe Domain Sequences for d1hxmf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxmf1 b.1.1.1 (F:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]}
aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
itd

SCOPe Domain Coordinates for d1hxmf1:

Click to download the PDB-style file with coordinates for d1hxmf1.
(The format of our PDB-style files is described here.)

Timeline for d1hxmf1: