Lineage for d1hxme2 (1hxm E:121-206)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762507Protein T-cell antigen receptor [49125] (7 species)
  7. 1762588Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63661] (2 PDB entries)
  8. 1762591Domain d1hxme2: 1hxm E:121-206 [61376]
    Other proteins in same PDB: d1hxma1, d1hxmb1, d1hxmc1, d1hxmd1, d1hxme1, d1hxmf1, d1hxmg1, d1hxmh1
    complexed with so4

Details for d1hxme2

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor
PDB Compounds: (E:) gamma-delta T-cell receptor

SCOPe Domain Sequences for d1hxme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxme2 b.1.1.2 (E:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]}
sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
gkyedsnsvtcsvqhdnktvhstdfe

SCOPe Domain Coordinates for d1hxme2:

Click to download the PDB-style file with coordinates for d1hxme2.
(The format of our PDB-style files is described here.)

Timeline for d1hxme2: