SCOP 1.63: Domain d1hxme2: 1hxm E:121-206

Lineage for d1hxme2 (1hxm E:121-206)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63661] (1 PDB entry)

8. Domain d1hxme2: 1hxm E:121-206 [61376]
   Other proteins in same PDB: d1hxma1, d1hxmb1, d1hxmc1, d1hxmd1, d1hxme1, d1hxmf1, d1hxmg1, d1hxmh1

Details for d1hxme2

PDB Entry: 1hxm, 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor

SCOP Domain Sequences for d1hxme2:

Sequence; same for both SEQRES and ATOM records:

>d1hxme2 b.1.1.2 (E:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain}
sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
gkyedsnsvtcsvqhdnktvhstdfe

Timeline for d1hxme2:

• d1hxme2 first appeared in SCOP 1.57
  
• d1hxme2 appears in SCOP 1.61
  
• d1hxme2 appears in SCOP 1.65
  
• d1hxme2 appears in the current release, SCOPe 2.08