Lineage for d1hxme1 (1hxm E:1-120)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 52846Protein T-cell antigen receptor [48933] (6 species)
  7. 52868Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (1 PDB entry)
  8. 52871Domain d1hxme1: 1hxm E:1-120 [61375]
    Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2

Details for d1hxme1

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor

SCOP Domain Sequences for d1hxme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxme1 b.1.1.1 (E:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain}
aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr

SCOP Domain Coordinates for d1hxme1:

Click to download the PDB-style file with coordinates for d1hxme1.
(The format of our PDB-style files is described here.)

Timeline for d1hxme1: