Lineage for d1hxmd1 (1hxm D:1-123)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 103212Protein T-cell antigen receptor [48933] (6 species)
  7. 103227Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (2 PDB entries)
  8. 103231Domain d1hxmd1: 1hxm D:1-123 [61373]
    Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2

Details for d1hxmd1

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor

SCOP Domain Sequences for d1hxmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxmd1 b.1.1.1 (D:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain}
aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
itd

SCOP Domain Coordinates for d1hxmd1:

Click to download the PDB-style file with coordinates for d1hxmd1.
(The format of our PDB-style files is described here.)

Timeline for d1hxmd1: