Lineage for d1hxmc2 (1hxm C:121-206)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1109120Protein T-cell antigen receptor [49125] (6 species)
  7. 1109194Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63661] (2 PDB entries)
  8. 1109196Domain d1hxmc2: 1hxm C:121-206 [61372]
    Other proteins in same PDB: d1hxma1, d1hxmb1, d1hxmc1, d1hxmd1, d1hxme1, d1hxmf1, d1hxmg1, d1hxmh1
    complexed with so4

Details for d1hxmc2

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor
PDB Compounds: (C:) gamma-delta T-cell receptor

SCOPe Domain Sequences for d1hxmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxmc2 b.1.1.2 (C:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]}
sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
gkyedsnsvtcsvqhdnktvhstdfe

SCOPe Domain Coordinates for d1hxmc2:

Click to download the PDB-style file with coordinates for d1hxmc2.
(The format of our PDB-style files is described here.)

Timeline for d1hxmc2: