![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (3 PDB entries) |
![]() | Domain d1hxmb1: 1hxm B:1-123 [61369] Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2 complexed with so4 |
PDB Entry: 1hxm (more details), 3.12 Å
SCOPe Domain Sequences for d1hxmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli itd
Timeline for d1hxmb1: