Lineage for d1hxma2 (1hxm A:121-206)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 54173Protein T-cell antigen receptor [49125] (6 species)
  7. 54192Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63661] (1 PDB entry)
  8. 54193Domain d1hxma2: 1hxm A:121-206 [61368]
    Other proteins in same PDB: d1hxma1, d1hxmb1, d1hxmc1, d1hxmd1, d1hxme1, d1hxmf1, d1hxmg1, d1hxmh1

Details for d1hxma2

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor

SCOP Domain Sequences for d1hxma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain}
sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
gkyedsnsvtcsvqhdnktvhstdfe

SCOP Domain Coordinates for d1hxma2:

Click to download the PDB-style file with coordinates for d1hxma2.
(The format of our PDB-style files is described here.)

Timeline for d1hxma2: