SCOP 1.73: Domain d1hxma1: 1hxm A:1-120

Lineage for d1hxma1 (1hxm A:1-120)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (1 PDB entry)

8. Domain d1hxma1: 1hxm A:1-120 [61367]
   Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2

Details for d1hxma1

PDB Entry: 1hxm, 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor

PDB Compounds: (A:) gamma-delta T-cell receptor

SCOP Domain Sequences for d1hxma1:

Sequence; same for both SEQRES and ATOM records:

>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]}
aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr

Timeline for d1hxma1:

• d1hxma1 first appeared in SCOP 1.57
  
• d1hxma1 appears in SCOP 1.71
  
• d1hxma1 appears in SCOP 1.75
  
• d1hxma1 appears in the current release, SCOPe 2.08