Lineage for d1hxia_ (1hxi A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775787Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 775837Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species)
  7. 775846Species Trypanosoma brucei [TaxId:5691] [63617] (1 PDB entry)
  8. 775847Domain d1hxia_: 1hxi A: [61366]
    complexed with mg

Details for d1hxia_

PDB Entry: 1hxi (more details), 1.6 Å

PDB Description: an unexpected extended conformation for the third tpr motif of the peroxin pex5 from trypanosoma brucei
PDB Compounds: (A:) Peroxisome targeting signal 1 receptor PEX5

SCOP Domain Sequences for d1hxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}
nntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqkepereeawrslgltq
aenekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawll

SCOP Domain Coordinates for d1hxia_:

Click to download the PDB-style file with coordinates for d1hxia_.
(The format of our PDB-style files is described here.)

Timeline for d1hxia_: