SCOP 1.57: Domain d1hxdb3: 1hxd B:64-270

Lineage for d1hxdb3 (1hxd B:64-270)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (1 protein)

6. Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species)

7. Species Escherichia coli [TaxId:562] [55709] (3 PDB entries)

8. Domain d1hxdb3: 1hxd B:64-270 [61365]
   Other proteins in same PDB: d1hxda1, d1hxda2, d1hxdb1, d1hxdb2

Details for d1hxdb3

PDB Entry: 1hxd, 2.4 Å

PDB Description: crystal structure of e. coli biotin repressor with bound biotin

SCOP Domain Sequences for d1hxdb3:

Sequence, based on SEQRES records:

>d1hxdb3 d.104.1.2 (B:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

Sequence, based on observed residues (ATOM records):

>d1hxdb3 d.104.1.2 (B:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamqgwitlqeaginldrntlaamlirelraalel
feqeglapylsrwekldn

Timeline for d1hxdb3:

• d1hxdb3 is new in SCOP 1.57
  
• d1hxdb3 appears in SCOP 1.59
  
• d1hxdb3 appears in the current release, SCOPe 2.08