SCOP 1.75: Domain d1hxdb1: 1hxd B:4-63

Lineage for d1hxdb1 (1hxd B:4-63)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.1: Biotin repressor-like [46786] (2 proteins)

6. Protein Biotin repressor, N-terminal domain [46787] (1 species)
   the middle domain is an alpha+beta fold somewhat similar to the SH2 fold
   C-terminal domain has SH3-like common fold

7. Species Escherichia coli [TaxId:562] [46788] (4 PDB entries)

8. Domain d1hxdb1: 1hxd B:4-63 [61363]
   Other proteins in same PDB: d1hxda2, d1hxda3, d1hxdb2, d1hxdb3
   complexed with btn

Details for d1hxdb1

PDB Entry: 1hxd, 2.4 Å

PDB Description: crystal structure of e. coli biotin repressor with bound biotin

PDB Compounds: (B:) BirA BIFUNCTIONAL PROTEIN

SCOP Domain Sequences for d1hxdb1:

Sequence; same for both SEQRES and ATOM records:

>d1hxdb1 a.4.5.1 (B:4-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]}
ntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpep

Timeline for d1hxdb1:

• d1hxdb1 first appeared in SCOP 1.57
  
• d1hxdb1 appears in SCOP 1.73
  
• d1hxdb1 appears in SCOPe 2.01
  
• d1hxdb1 appears in the current release, SCOPe 2.08