Lineage for d1hxda3 (1hxd A:64-270)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608836Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 608837Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 609017Family d.104.1.2: Biotin holoenzyme synthetase [55707] (1 protein)
  6. 609018Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species)
    this structure contains an SH2-like fold
  7. 609019Species Escherichia coli [TaxId:562] [55709] (3 PDB entries)
  8. 609021Domain d1hxda3: 1hxd A:64-270 [61362]
    Other proteins in same PDB: d1hxda1, d1hxda2, d1hxdb1, d1hxdb2

Details for d1hxda3

PDB Entry: 1hxd (more details), 2.4 Å

PDB Description: crystal structure of e. coli biotin repressor with bound biotin

SCOP Domain Sequences for d1hxda3:

Sequence, based on SEQRES records: (download)

>d1hxda3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

Sequence, based on observed residues (ATOM records): (download)

>d1hxda3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamqgwitlqeaginldrntlaamlirelraalel
feqeglapylsrwekldn

SCOP Domain Coordinates for d1hxda3:

Click to download the PDB-style file with coordinates for d1hxda3.
(The format of our PDB-style files is described here.)

Timeline for d1hxda3: