SCOPe 2.08: Domain d1hxda2: 1hxd A:271-317

Lineage for d1hxda2 (1hxd A:271-317)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.1: Biotin repressor (BirA) [50038] (2 proteins)
   automatically mapped to Pfam PF02237

6. Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)

7. Species Escherichia coli [TaxId:562] [50040] (4 PDB entries)

8. Domain d1hxda2: 1hxd A:271-317 [61361]
   Other proteins in same PDB: d1hxda1, d1hxda3, d1hxdb1, d1hxdb3
   complexed with btn

Details for d1hxda2

PDB Entry: 1hxd, 2.4 Å

PDB Description: crystal structure of e. coli biotin repressor with bound biotin

PDB Compounds: (A:) BirA BIFUNCTIONAL PROTEIN

SCOPe Domain Sequences for d1hxda2:

Sequence; same for both SEQRES and ATOM records:

>d1hxda2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

Timeline for d1hxda2:

• d1hxda2 first appeared in SCOP 1.57
  
• d1hxda2 appears in SCOPe 2.07