Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.1: Biotin repressor-like [46786] (2 proteins) |
Protein Biotin repressor, N-terminal domain [46787] (1 species) the middle domain is an alpha+beta fold somewhat similar to the SH2 fold C-terminal domain has SH3-like common fold |
Species Escherichia coli [TaxId:562] [46788] (4 PDB entries) |
Domain d1hxda1: 1hxd A:4-63 [61360] Other proteins in same PDB: d1hxda2, d1hxda3, d1hxdb2, d1hxdb3 |
PDB Entry: 1hxd (more details), 2.4 Å
SCOP Domain Sequences for d1hxda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxda1 a.4.5.1 (A:4-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} ntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpep
Timeline for d1hxda1: