Lineage for d1hxda1 (1hxd A:4-63)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45501Family a.4.5.1: Biotin repressor, N-terminal domain [46786] (1 protein)
  6. 45502Protein Biotin repressor, N-terminal domain [46787] (1 species)
  7. 45503Species Escherichia coli [TaxId:562] [46788] (3 PDB entries)
  8. 45505Domain d1hxda1: 1hxd A:4-63 [61360]
    Other proteins in same PDB: d1hxda2, d1hxda3, d1hxdb2, d1hxdb3

Details for d1hxda1

PDB Entry: 1hxd (more details), 2.4 Å

PDB Description: crystal structure of e. coli biotin repressor with bound biotin

SCOP Domain Sequences for d1hxda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxda1 a.4.5.1 (A:4-63) Biotin repressor, N-terminal domain {Escherichia coli}
ntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpep

SCOP Domain Coordinates for d1hxda1:

Click to download the PDB-style file with coordinates for d1hxda1.
(The format of our PDB-style files is described here.)

Timeline for d1hxda1: