Lineage for d1hx5f_ (1hx5 F:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 797353Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 797354Family b.35.1.1: GroES [50130] (2 proteins)
  6. 797355Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 797414Species Mycobacterium tuberculosis [TaxId:1773] [63753] (2 PDB entries)
  8. 797434Domain d1hx5f_: 1hx5 F: [61358]

Details for d1hx5f_

PDB Entry: 1hx5 (more details), 3.5 Å

PDB Description: crystal structure of m. tuberculosis chaperonin-10
PDB Compounds: (F:) 10 kda chaperonin

SCOP Domain Sequences for d1hx5f_:

Sequence, based on SEQRES records: (download)

>d1hx5f_ b.35.1.1 (F:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]}
ikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripldvae
gdtviyskyggteikyngeeylilsardvlavv

Sequence, based on observed residues (ATOM records): (download)

>d1hx5f_ b.35.1.1 (F:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]}
ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
teikyngeeylilsardvlavv

SCOP Domain Coordinates for d1hx5f_:

Click to download the PDB-style file with coordinates for d1hx5f_.
(The format of our PDB-style files is described here.)

Timeline for d1hx5f_: