SCOP 1.73: Domain d1hx5e_: 1hx5 E:

Lineage for d1hx5e_ (1hx5 E:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.1: GroES [50130] (2 proteins)

6. Protein Chaperonin-10 (GroES) [50131] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [63753] (2 PDB entries)

8. Domain d1hx5e_: 1hx5 E: [61357]

Details for d1hx5e_

PDB Entry: 1hx5, 3.5 Å

PDB Description: crystal structure of m. tuberculosis chaperonin-10

PDB Compounds: (E:) 10 kda chaperonin

SCOP Domain Sequences for d1hx5e_:

Sequence, based on SEQRES records:

>d1hx5e_ b.35.1.1 (E:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]}
ikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripldvae
gdtviyskyggteikyngeeylilsardvlavv

Sequence, based on observed residues (ATOM records):

>d1hx5e_ b.35.1.1 (E:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]}
ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
teikyngeeylilsardvlavv

Timeline for d1hx5e_:

• d1hx5e_ first appeared in SCOP 1.57
  
• d1hx5e_ appears in SCOP 1.71
  
• d1hx5e_ appears in SCOP 1.75
  
• d1hx5e_ appears in the current release, SCOPe 2.08