Lineage for d1hx5e_ (1hx5 E:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165795Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 165796Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 165797Family b.35.1.1: GroES [50130] (2 proteins)
  6. 165798Protein Chaperonin-10 (GroES) [50131] (3 species)
  7. 165815Species Mycobacterium tuberculosis [TaxId:1773] [63753] (2 PDB entries)
  8. 165834Domain d1hx5e_: 1hx5 E: [61357]

Details for d1hx5e_

PDB Entry: 1hx5 (more details), 3.5 Å

PDB Description: crystal structure of m. tuberculosis chaperonin-10

SCOP Domain Sequences for d1hx5e_:

Sequence, based on SEQRES records: (download)

>d1hx5e_ b.35.1.1 (E:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis}
ikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripldvae
gdtviyskyggteikyngeeylilsardvlavv

Sequence, based on observed residues (ATOM records): (download)

>d1hx5e_ b.35.1.1 (E:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis}
ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
teikyngeeylilsardvlavv

SCOP Domain Coordinates for d1hx5e_:

Click to download the PDB-style file with coordinates for d1hx5e_.
(The format of our PDB-style files is described here.)

Timeline for d1hx5e_: