SCOPe 2.03: Domain d1hx5b_: 1hx5 B:

Lineage for d1hx5b_ (1hx5 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.1: GroES [50130] (2 proteins)
   automatically mapped to Pfam PF00166

6. Protein Chaperonin-10 (GroES) [50131] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [63753] (2 PDB entries)

8. Domain d1hx5b_: 1hx5 B: [61354]

Details for d1hx5b_

PDB Entry: 1hx5, 3.5 Å

PDB Description: crystal structure of m. tuberculosis chaperonin-10

PDB Compounds: (B:) 10 kda chaperonin

SCOPe Domain Sequences for d1hx5b_:

Sequence, based on SEQRES records:

>d1hx5b_ b.35.1.1 (B:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]}
ikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripldvae
gdtviyskyggteikyngeeylilsardvlavv

Sequence, based on observed residues (ATOM records):

>d1hx5b_ b.35.1.1 (B:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]}
ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
teikyngeeylilsardvlavv

Timeline for d1hx5b_:

• d1hx5b_ first appeared in SCOP 1.57
  
• d1hx5b_ appears in SCOPe 2.02
  
• d1hx5b_ appears in SCOPe 2.04
  
• d1hx5b_ appears in the current release, SCOPe 2.08