Lineage for d1hx5b_ (1hx5 B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227997Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 227998Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 227999Family b.35.1.1: GroES [50130] (2 proteins)
  6. 228000Protein Chaperonin-10 (GroES) [50131] (3 species)
  7. 228017Species Mycobacterium tuberculosis [TaxId:1773] [63753] (2 PDB entries)
  8. 228033Domain d1hx5b_: 1hx5 B: [61354]

Details for d1hx5b_

PDB Entry: 1hx5 (more details), 3.5 Å

PDB Description: crystal structure of m. tuberculosis chaperonin-10

SCOP Domain Sequences for d1hx5b_:

Sequence, based on SEQRES records: (download)

>d1hx5b_ b.35.1.1 (B:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis}
ikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripldvae
gdtviyskyggteikyngeeylilsardvlavv

Sequence, based on observed residues (ATOM records): (download)

>d1hx5b_ b.35.1.1 (B:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis}
ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
teikyngeeylilsardvlavv

SCOP Domain Coordinates for d1hx5b_:

Click to download the PDB-style file with coordinates for d1hx5b_.
(The format of our PDB-style files is described here.)

Timeline for d1hx5b_: