![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (5 families) ![]() |
![]() | Family d.113.1.2: IPP isomerase-like [64369] (2 proteins) |
![]() | Protein Isopentenyl diphosphate isomerase [64370] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64371] (11 PDB entries) |
![]() | Domain d1hx3b_: 1hx3 B: [61352] complexed with imd, mn, so4; mutant |
PDB Entry: 1hx3 (more details), 2.1 Å
SCOP Domain Sequences for d1hx3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hx3b_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli} ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl
Timeline for d1hx3b_: