SCOP 1.57: Domain d1hx3b_: 1hx3 B:

Lineage for d1hx3b_ (1hx3 B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)

4. Superfamily d.113.1: Nudix [55811] (2 families)

5. Family d.113.1.2: Isopentenyl diphosphate isomerase [64369] (1 protein)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (3 PDB entries)

8. Domain d1hx3b_: 1hx3 B: [61352]

Details for d1hx3b_

PDB Entry: 1hx3, 2.1 Å

PDB Description: crystal structure of e.coli isopentenyl diphosphate:dimethylallyl diphosphate isomerase

SCOP Domain Sequences for d1hx3b_:

Sequence; same for both SEQRES and ATOM records:

>d1hx3b_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl

Timeline for d1hx3b_:

• d1hx3b_ is new in SCOP 1.57
  
• d1hx3b_ appears in SCOP 1.59
  
• d1hx3b_ appears in the current release, SCOPe 2.08, called d1hx3b1