Lineage for d1hx1a2 (1hx1 A:189-381)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2137195Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2137461Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 2137462Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 2137502Domain d1hx1a2: 1hx1 A:189-381 [61349]
    Other proteins in same PDB: d1hx1b1, d1hx1b2
    complexed with trs

Details for d1hx1a2

PDB Entry: 1hx1 (more details), 1.9 Å

PDB Description: crystal structure of a bag domain in complex with the hsc70 atpase domain
PDB Compounds: (A:) Heat shock 70 kDa protein 8

SCOPe Domain Sequences for d1hx1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hx1a2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

SCOPe Domain Coordinates for d1hx1a2:

Click to download the PDB-style file with coordinates for d1hx1a2.
(The format of our PDB-style files is described here.)

Timeline for d1hx1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hx1a1