SCOP 1.75: Domain d1hx1a2: 1hx1 A:189-381

Lineage for d1hx1a2 (1hx1 A:189-381)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)

8. Domain d1hx1a2: 1hx1 A:189-381 [61349]
   Other proteins in same PDB: d1hx1b_
   complexed with trs

Details for d1hx1a2

PDB Entry: 1hx1, 1.9 Å

PDB Description: crystal structure of a bag domain in complex with the hsc70 atpase domain

PDB Compounds: (A:) heat shock cognate 71 kda

SCOP Domain Sequences for d1hx1a2:

Sequence; same for both SEQRES and ATOM records:

>d1hx1a2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

Timeline for d1hx1a2:

• d1hx1a2 first appeared in SCOP 1.57
  
• d1hx1a2 appears in SCOP 1.73
  
• d1hx1a2 appears in SCOPe 2.01
  
• d1hx1a2 appears in the current release, SCOPe 2.08