SCOPe 2.06: Domain d1hwld2: 1hwl D:479-586,D:704-860

Lineage for d1hwld2 (1hwl D:479-586,D:704-860)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
   unusual fold

4. Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family)

5. Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)

6. Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)

8. Domain d1hwld2: 1hwl D:479-586,D:704-860 [61345]
   Other proteins in same PDB: d1hwla1, d1hwlb1, d1hwlc1, d1hwld1
   complexed with adp, fbi

Details for d1hwld2

PDB Entry: 1hwl, 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with rosuvastatin (formally known as zd4522)

PDB Compounds: (D:) hmg-coa reductase

SCOPe Domain Sequences for d1hwld2:

Sequence; same for both SEQRES and ATOM records:

>d1hwld2 d.179.1.1 (D:479-586,D:704-860) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
ykletliethergvsirrqllskklsepsslqylpyrdynyslvmgaccenvigympipv
gvagplcldekefqvpmattegclvastnrgcraiglgggassrvladXksvvceavipa
kvvrevlkttteamievninknlvgsamagsiggynahaanivtaiyiacgqdaaqnvgs
sncitlmeasgptnedlyisctmpsieigtvgggtnllpqqaclqmlgvqgackdnpgen
arqlarivcgtvmagelslmaalaag

Timeline for d1hwld2:

• d1hwld2 first appeared in SCOP 1.57
  
• d1hwld2 appears in SCOPe 2.05
  
• d1hwld2 appears in SCOPe 2.07
  
• d1hwld2 appears in the current release, SCOPe 2.08