SCOP 1.65: Domain d1hwld1: 1hwl D:587-703

Lineage for d1hwld1 (1hwl D:587-703)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family)

5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)

6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)

8. Domain d1hwld1: 1hwl D:587-703 [61344]
   Other proteins in same PDB: d1hwla2, d1hwlb2, d1hwlc2, d1hwld2
   complexed with adp, fbi; mutant

Details for d1hwld1

PDB Entry: 1hwl, 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with rosuvastatin (formally known as zd4522)

SCOP Domain Sequences for d1hwld1:

Sequence; same for both SEQRES and ATOM records:

>d1hwld1 d.58.20.1 (D:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

Timeline for d1hwld1:

• d1hwld1 first appeared in SCOP 1.57
  
• d1hwld1 appears in SCOP 1.63
  
• d1hwld1 appears in SCOP 1.67
  
• d1hwld1 appears in the current release, SCOPe 2.08