Lineage for d1hwlc2 (1hwl C:463-586,C:704-860)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237465Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 2237466Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 2237467Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 2237468Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 2237469Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
  8. 2237480Domain d1hwlc2: 1hwl C:463-586,C:704-860 [61343]
    Other proteins in same PDB: d1hwla1, d1hwlb1, d1hwlc1, d1hwld1
    complexed with adp, fbi

Details for d1hwlc2

PDB Entry: 1hwl (more details), 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with rosuvastatin (formally known as zd4522)
PDB Compounds: (C:) hmg-coa reductase

SCOPe Domain Sequences for d1hwlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwlc2 d.179.1.1 (C:463-586,C:704-860) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
sdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynyslv
mgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggassr
vladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaanivt
aiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqacl
qmlgvqgackdnpgenarqlarivcgtvmagelslmaalaag

SCOPe Domain Coordinates for d1hwlc2:

Click to download the PDB-style file with coordinates for d1hwlc2.
(The format of our PDB-style files is described here.)

Timeline for d1hwlc2: