Lineage for d1hwlb2 (1hwl B:463-586,B:704-860)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610788Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 2610789Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 2610790Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 2610791Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 2610792Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
  8. 2610798Domain d1hwlb2: 1hwl B:463-586,B:704-860 [61341]
    Other proteins in same PDB: d1hwla1, d1hwlb1, d1hwlc1, d1hwld1
    complexed with adp, fbi

Details for d1hwlb2

PDB Entry: 1hwl (more details), 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with rosuvastatin (formally known as zd4522)
PDB Compounds: (B:) hmg-coa reductase

SCOPe Domain Sequences for d1hwlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwlb2 d.179.1.1 (B:463-586,B:704-860) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
sdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynyslv
mgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggassr
vladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaanivt
aiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqacl
qmlgvqgackdnpgenarqlarivcgtvmagelslmaalaag

SCOPe Domain Coordinates for d1hwlb2:

Click to download the PDB-style file with coordinates for d1hwlb2.
(The format of our PDB-style files is described here.)

Timeline for d1hwlb2: