Lineage for d1hwkc2 (1hwk C:462-586,C:704-860)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86006Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
  4. 86007Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 86008Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 86009Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 86010Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
  8. 86033Domain d1hwkc2: 1hwk C:462-586,C:704-860 [61335]
    Other proteins in same PDB: d1hwka1, d1hwkb1, d1hwkc1, d1hwkd1

Details for d1hwkc2

PDB Entry: 1hwk (more details), 2.22 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with atorvastatin

SCOP Domain Sequences for d1hwkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwkc2 d.179.1.1 (C:462-586,C:704-860) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
lsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynysl
vmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggass
rvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaaniv
taiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqac
lqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaag

SCOP Domain Coordinates for d1hwkc2:

Click to download the PDB-style file with coordinates for d1hwkc2.
(The format of our PDB-style files is described here.)

Timeline for d1hwkc2: