Lineage for d1hwjc1 (1hwj C:587-703)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954390Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 2954391Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 2954392Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 2954393Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)
  8. 2954408Domain d1hwjc1: 1hwj C:587-703 [61326]
    Other proteins in same PDB: d1hwja2, d1hwjb2, d1hwjc2, d1hwjd2
    complexed with 116, adp

Details for d1hwjc1

PDB Entry: 1hwj (more details), 2.26 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with cerivastatin
PDB Compounds: (C:) hmg-coa reductase

SCOPe Domain Sequences for d1hwjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwjc1 d.58.20.1 (C:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

SCOPe Domain Coordinates for d1hwjc1:

Click to download the PDB-style file with coordinates for d1hwjc1.
(The format of our PDB-style files is described here.)

Timeline for d1hwjc1: