SCOP 1.73: Domain d1hwjb2: 1hwj B:463-586,B:704-860

Lineage for d1hwjb2 (1hwj B:463-586,B:704-860)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
   unusual fold

4. Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family)

5. Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)

6. Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)

8. Domain d1hwjb2: 1hwj B:463-586,B:704-860 [61325]
   Other proteins in same PDB: d1hwja1, d1hwjb1, d1hwjc1, d1hwjd1

Details for d1hwjb2

PDB Entry: 1hwj, 2.26 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with cerivastatin

PDB Compounds: (B:) hmg-coa reductase

SCOP Domain Sequences for d1hwjb2:

Sequence; same for both SEQRES and ATOM records:

>d1hwjb2 d.179.1.1 (B:463-586,B:704-860) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
sdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynyslv
mgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggassr
vladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaanivt
aiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqacl
qmlgvqgackdnpgenarqlarivcgtvmagelslmaalaag

Timeline for d1hwjb2:

• d1hwjb2 first appeared in SCOP 1.57
  
• d1hwjb2 appears in SCOP 1.71
  
• d1hwjb2 appears in SCOP 1.75
  
• d1hwjb2 appears in the current release, SCOPe 2.08