Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily) unusual fold |
Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) |
Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein) |
Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries) |
Domain d1hwjb2: 1hwj B:463-586,B:704-860 [61325] Other proteins in same PDB: d1hwja1, d1hwjb1, d1hwjc1, d1hwjd1 |
PDB Entry: 1hwj (more details), 2.26 Å
SCOP Domain Sequences for d1hwjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwjb2 d.179.1.1 (B:463-586,B:704-860) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]} sdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynyslv mgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggassr vladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaanivt aiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqacl qmlgvqgackdnpgenarqlarivcgtvmagelslmaalaag
Timeline for d1hwjb2: