Lineage for d1hwjb1 (1hwj B:587-703)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80644Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 80645Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 80646Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 80647Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)
  8. 80673Domain d1hwjb1: 1hwj B:587-703 [61324]
    Other proteins in same PDB: d1hwja2, d1hwjb2, d1hwjc2, d1hwjd2

Details for d1hwjb1

PDB Entry: 1hwj (more details), 2.26 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with cerivastatin

SCOP Domain Sequences for d1hwjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwjb1 d.58.20.1 (B:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

SCOP Domain Coordinates for d1hwjb1:

Click to download the PDB-style file with coordinates for d1hwjb1.
(The format of our PDB-style files is described here.)

Timeline for d1hwjb1: