Lineage for d1hwja1 (1hwj A:587-703)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412909Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 412910Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 412911Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 412912Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)
  8. 412941Domain d1hwja1: 1hwj A:587-703 [61322]
    Other proteins in same PDB: d1hwja2, d1hwjb2, d1hwjc2, d1hwjd2

Details for d1hwja1

PDB Entry: 1hwj (more details), 2.26 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with cerivastatin

SCOP Domain Sequences for d1hwja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwja1 d.58.20.1 (A:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

SCOP Domain Coordinates for d1hwja1:

Click to download the PDB-style file with coordinates for d1hwja1.
(The format of our PDB-style files is described here.)

Timeline for d1hwja1: