Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) |
Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein) |
Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries) |
Domain d1hwid1: 1hwi D:587-703 [61320] Other proteins in same PDB: d1hwia2, d1hwib2, d1hwic2, d1hwid2 complexed with 115, adp; mutant |
PDB Entry: 1hwi (more details), 2.3 Å
SCOP Domain Sequences for d1hwid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwid1 d.58.20.1 (D:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)} gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg
Timeline for d1hwid1: