Lineage for d1hwid1 (1hwi D:587-703)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257876Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 257877Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 257878Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 257879Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)
  8. 257899Domain d1hwid1: 1hwi D:587-703 [61320]
    Other proteins in same PDB: d1hwia2, d1hwib2, d1hwic2, d1hwid2
    complexed with 115, adp; mutant

Details for d1hwid1

PDB Entry: 1hwi (more details), 2.3 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with fluvastatin

SCOP Domain Sequences for d1hwid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwid1 d.58.20.1 (D:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

SCOP Domain Coordinates for d1hwid1:

Click to download the PDB-style file with coordinates for d1hwid1.
(The format of our PDB-style files is described here.)

Timeline for d1hwid1: