Lineage for d1hwic2 (1hwi C:489-586,C:704-862)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86006Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
  4. 86007Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 86008Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 86009Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 86010Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
  8. 86029Domain d1hwic2: 1hwi C:489-586,C:704-862 [61319]
    Other proteins in same PDB: d1hwia1, d1hwib1, d1hwic1, d1hwid1

Details for d1hwic2

PDB Entry: 1hwi (more details), 2.3 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with fluvastatin

SCOP Domain Sequences for d1hwic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwic2 d.179.1.1 (C:489-586,C:704-862) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
ergvsirrqllskklsepsslqylpyrdynyslvmgaccenvigympipvgvagplclde
kefqvpmattegclvastnrgcraiglgggassrvladXksvvceavipakvvrevlktt
teamievninknlvgsamagsiggynahaanivtaiyiacgqdaaqnvgssncitlmeas
gptnedlyisctmpsieigtvgggtnllpqqaclqmlgvqgackdnpgenarqlarivcg
tvmagelslmaalaaghl

SCOP Domain Coordinates for d1hwic2:

Click to download the PDB-style file with coordinates for d1hwic2.
(The format of our PDB-style files is described here.)

Timeline for d1hwic2: