![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily) |
![]() | Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) ![]() |
![]() | Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein) |
![]() | Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries) |
![]() | Domain d1hwic2: 1hwi C:489-586,C:704-862 [61319] Other proteins in same PDB: d1hwia1, d1hwib1, d1hwic1, d1hwid1 |
PDB Entry: 1hwi (more details), 2.3 Å
SCOP Domain Sequences for d1hwic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwic2 d.179.1.1 (C:489-586,C:704-862) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)} ergvsirrqllskklsepsslqylpyrdynyslvmgaccenvigympipvgvagplclde kefqvpmattegclvastnrgcraiglgggassrvladXksvvceavipakvvrevlktt teamievninknlvgsamagsiggynahaanivtaiyiacgqdaaqnvgssncitlmeas gptnedlyisctmpsieigtvgggtnllpqqaclqmlgvqgackdnpgenarqlarivcg tvmagelslmaalaaghl
Timeline for d1hwic2: