SCOPe 2.07: Domain d1hwib2: 1hwi B:462-586,B:704-860

Lineage for d1hwib2 (1hwi B:462-586,B:704-860)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
   unusual fold

4. Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family)

5. Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)

6. Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)

8. Domain d1hwib2: 1hwi B:462-586,B:704-860 [61317]
   Other proteins in same PDB: d1hwia1, d1hwib1, d1hwic1, d1hwid1
   complexed with 115, adp

Details for d1hwib2

PDB Entry: 1hwi, 2.3 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with fluvastatin

PDB Compounds: (B:) hmg-coa reductase

SCOPe Domain Sequences for d1hwib2:

Sequence; same for both SEQRES and ATOM records:

>d1hwib2 d.179.1.1 (B:462-586,B:704-860) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
lsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynysl
vmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggass
rvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaaniv
taiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqac
lqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaag

Timeline for d1hwib2:

• d1hwib2 first appeared in SCOP 1.57
  
• d1hwib2 appears in SCOPe 2.06
  
• d1hwib2 appears in the current release, SCOPe 2.08