SCOP 1.57: Domain d1hwia1: 1hwi A:587-703

Lineage for d1hwia1 (1hwi A:587-703)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family)

5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)

6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)

8. Domain d1hwia1: 1hwi A:587-703 [61314]
   Other proteins in same PDB: d1hwia2, d1hwib2, d1hwic2, d1hwid2

Details for d1hwia1

PDB Entry: 1hwi, 2.3 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with fluvastatin

SCOP Domain Sequences for d1hwia1:

Sequence; same for both SEQRES and ATOM records:

>d1hwia1 d.58.20.1 (A:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

Timeline for d1hwia1:

• d1hwia1 is new in SCOP 1.57
  
• d1hwia1 appears in SCOP 1.59
  
• d1hwia1 appears in the current release, SCOPe 2.08