Lineage for d1hw9c1 (1hw9 C:587-703)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604614Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 604615Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 604616Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 604617Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)
  8. 604644Domain d1hw9c1: 1hw9 C:587-703 [61310]
    Other proteins in same PDB: d1hw9a2, d1hw9b2, d1hw9c2, d1hw9d2

Details for d1hw9c1

PDB Entry: 1hw9 (more details), 2.33 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with simvastatin

SCOP Domain Sequences for d1hw9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hw9c1 d.58.20.1 (C:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

SCOP Domain Coordinates for d1hw9c1:

Click to download the PDB-style file with coordinates for d1hw9c1.
(The format of our PDB-style files is described here.)

Timeline for d1hw9c1: