SCOPe 2.07: Domain d1hw8d2: 1hw8 D:488-586,D:704-859

Lineage for d1hw8d2 (1hw8 D:488-586,D:704-859)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
   unusual fold

4. Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family)

5. Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)

6. Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)

8. Domain d1hw8d2: 1hw8 D:488-586,D:704-859 [61305]
   Other proteins in same PDB: d1hw8a1, d1hw8b1, d1hw8c1, d1hw8d1
   complexed with 114, adp

Details for d1hw8d2

PDB Entry: 1hw8, 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with compactin (also known as mevastatin)

PDB Compounds: (D:) hmg-coa reductase

SCOPe Domain Sequences for d1hw8d2:

Sequence; same for both SEQRES and ATOM records:

>d1hw8d2 d.179.1.1 (D:488-586,D:704-859) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
hergvsirrqllskklsepsslqylpyrdynyslvmgaccenvigympipvgvagplcld
ekefqvpmattegclvastnrgcraiglgggassrvladXksvvceavipakvvrevlkt
tteamievninknlvgsamagsiggynahaanivtaiyiacgqdaaqnvgssncitlmea
sgptnedlyisctmpsieigtvgggtnllpqqaclqmlgvqgackdnpgenarqlarivc
gtvmagelslmaalaa

Timeline for d1hw8d2:

• d1hw8d2 first appeared in SCOP 1.57
  
• d1hw8d2 appears in SCOPe 2.06
  
• d1hw8d2 appears in the current release, SCOPe 2.08