SCOPe 2.07: Domain d1hw8a1: 1hw8 A:587-703

Lineage for d1hw8a1 (1hw8 A:587-703)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family)

5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)

6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)

8. Domain d1hw8a1: 1hw8 A:587-703 [61298]
   Other proteins in same PDB: d1hw8a2, d1hw8b2, d1hw8c2, d1hw8d2
   complexed with 114, adp

Details for d1hw8a1

PDB Entry: 1hw8, 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with compactin (also known as mevastatin)

PDB Compounds: (A:) hmg-coa reductase

SCOPe Domain Sequences for d1hw8a1:

Sequence; same for both SEQRES and ATOM records:

>d1hw8a1 d.58.20.1 (A:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

Timeline for d1hw8a1:

• d1hw8a1 first appeared in SCOP 1.57
  
• d1hw8a1 appears in SCOPe 2.06
  
• d1hw8a1 appears in the current release, SCOPe 2.08