Lineage for d1hw7a_ (1hw7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005820Fold d.193: Hsp33 domain [64396] (1 superfamily)
    3 layers: beta/alpha/beta; buried helix
  4. 3005821Superfamily d.193.1: Hsp33 domain [64397] (1 family) (S)
    automatically mapped to Pfam PF01430
  5. 3005822Family d.193.1.1: Hsp33 domain [64398] (2 proteins)
    forms strand-swapped dimer
  6. 3005823Protein Heat shock protein 33, Hsp33 [64399] (3 species)
  7. 3005827Species Escherichia coli [TaxId:562] [64400] (2 PDB entries)
  8. 3005828Domain d1hw7a_: 1hw7 A: [61297]
    complexed with mes, so4, zn

Details for d1hw7a_

PDB Entry: 1hw7 (more details), 2.2 Å

PDB Description: hsp33, heat shock protein with redox-regulated chaperone activity
PDB Compounds: (A:) heat shock protein hsp33

SCOPe Domain Sequences for d1hw7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hw7a_ d.193.1.1 (A:) Heat shock protein 33, Hsp33 {Escherichia coli [TaxId: 562]}
hdqlhrylfenfavrgelvtvsetlqqilenhdypqpvknvlaellvatslltatlkfdg
ditvqlqgdgpmnlavingnnnqqmrgvarvqgeipenadlktlvgngyvvititpsege
ryqgvvglegdtlaacledyfmrseqlptrlfirtgdvdgkpaaggmllqvmpaqnaqqd
dfdhlatltetikteelltlpanevlwrlyheeevtvydpqdvefkctc

SCOPe Domain Coordinates for d1hw7a_:

Click to download the PDB-style file with coordinates for d1hw7a_.
(The format of our PDB-style files is described here.)

Timeline for d1hw7a_: