Lineage for d1hw6a_ (1hw6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2080915Protein 2,5-diketo-D-gluconic acid reductase A [51443] (3 species)
  7. 2080916Species Corynebacterium sp. [TaxId:1720] [51444] (3 PDB entries)
  8. 2080917Domain d1hw6a_: 1hw6 A: [61296]
    complexed with cl, mg

Details for d1hw6a_

PDB Entry: 1hw6 (more details), 1.9 Å

PDB Description: crystal structure of apo-2,5-diketo-d-gluconate reductase
PDB Compounds: (A:) 2,5-diketo-d-gluconic acid reductase

SCOPe Domain Sequences for d1hw6a_:

Sequence, based on SEQRES records: (download)

>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]}
tvpsivlndgnsipqlgygvfkvppadtqraveealevgyrhidtaaiygneegvgaaia
asgiarddlfittklwndrhdgdepaaaiaeslaklaldqvdlylvhwptpaadnyvhaw
ekmielraagltrsigvsnhlvphlerivaatgvvpavnqielhpayqqreitdwaaahd
vkieswgplgqgkydlfgaepvtaaaaahgktpaqavlrwhlqkgfvvfpksvrrerlee
nldvfdfdltdteiaaidamdp

Sequence, based on observed residues (ATOM records): (download)

>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]}
tvpsivlndgnsipqlgygvfkvppadtqraveealevgyrhidtaaiygneegvgaaia
asgiarddlfittklwndepaaaiaeslaklaldqvdlylvhwptpaadnyvhawekmie
lraagltrsigvsnhlvphlerivaatgvvpavnqielhpayqqreitdwaaahdvkies
wgplgqgkydlfgaepvtaaaaahgktpaqavlrwhlqkgfvvfpksvrrerleenldvf
dfdltdteiaaidamdp

SCOPe Domain Coordinates for d1hw6a_:

Click to download the PDB-style file with coordinates for d1hw6a_.
(The format of our PDB-style files is described here.)

Timeline for d1hw6a_: