Lineage for d1hv6a_ (1hv6 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774353Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 774354Family a.102.3.1: Alginate lyase A1-III [48231] (1 protein)
  6. 774355Protein Alginate lyase A1-III [48232] (1 species)
  7. 774356Species Sphingomonas sp., A1 [TaxId:28214] [48233] (2 PDB entries)
  8. 774358Domain d1hv6a_: 1hv6 A: [61294]
    complexed with gc4, gcu, so4

Details for d1hv6a_

PDB Entry: 1hv6 (more details), 2 Å

PDB Description: crystal structure of alginate lyase a1-iii complexed with trisaccharide product.
PDB Compounds: (A:) Alginate lyase

SCOP Domain Sequences for d1hv6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv6a_ a.102.3.1 (A:) Alginate lyase A1-III {Sphingomonas sp., A1 [TaxId: 28214]}
gshpfdqavvkdptasyvdvkarrtflqsgqlddrlkaalpkeydctteatpnpqqgemv
iprrylsgnhgpvnpdyepvvtlyrdfekisatlgnlyvatgkpvyatcllnmldkwaka
dallnydpksqswyqvewsaataafalstmmaepnvdtaqrervvkwlnrvarhqtsfpg
gdtsccnnhsywrgqeatiigviskddelfrwglgryvqamglinedgsfvhemtrheqs
lhyqnyamlpltmiaetasrqgidlyaykengrdihsarkfvfaavknpdlikkyasepq
dtrafkpgrgdlnwieyqrarfgfadelgfmtvpifdprtggsatllaykp

SCOP Domain Coordinates for d1hv6a_:

Click to download the PDB-style file with coordinates for d1hv6a_.
(The format of our PDB-style files is described here.)

Timeline for d1hv6a_: