SCOPe 2.05: Domain d1hv5f_: 1hv5 F:

Lineage for d1hv5f_ (1hv5 F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-3 (MMP-11) [64341] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64342] (1 PDB entry)

8. Domain d1hv5f_: 1hv5 F: [61293]
   complexed with ca, cps, rxp, zn

Details for d1hv5f_

PDB Entry: 1hv5, 2.6 Å

PDB Description: crystal structure of the stromelysin-3 (mmp-11) catalytic domain complexed with a phosphinic inhibitor

PDB Compounds: (F:) stromelysin 3

SCOPe Domain Sequences for d1hv5f_:

Sequence; same for both SEQRES and ATOM records:

>d1hv5f_ d.92.1.11 (F:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]}
mfvlsggrwektdltyrilrfpwqlvreqvrqtvaealqvwsevtpltftevhegradim
idfarywhgdnlpfdgpggilahaffpkthregdvhfdydetwtigdnqgtdllqvaahe
fghvlglqhttaakalmspfytfryplslspddrrgiqhlyg

Timeline for d1hv5f_:

• d1hv5f_ first appeared in SCOP 1.57
  
• d1hv5f_ appears in SCOPe 2.04
  
• d1hv5f_ appears in SCOPe 2.06
  
• d1hv5f_ appears in the current release, SCOPe 2.08