SCOP 1.61: Domain d1hv5a_: 1hv5 A:

Lineage for d1hv5a_ (1hv5 A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)

6. Protein Stromelysin-3 (MMP-11) [64341] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64342] (1 PDB entry)

8. Domain d1hv5a_: 1hv5 A: [61288]

Details for d1hv5a_

PDB Entry: 1hv5, 2.6 Å

PDB Description: crystal structure of the stromelysin-3 (mmp-11) catalytic domain complexed with a phosphinic inhibitor

SCOP Domain Sequences for d1hv5a_:

Sequence; same for both SEQRES and ATOM records:

>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus)}
mfvlsggrwektdltyrilrfpwqlvreqvrqtvaealqvwsevtpltftevhegradim
idfarywhgdnlpfdgpggilahaffpkthregdvhfdydetwtigdnqgtdllqvaahe
fghvlglqhttaakalmspfytfryplslspddrrgiqhlyg

Timeline for d1hv5a_:

• d1hv5a_ first appeared in SCOP 1.57
  
• d1hv5a_ appears in SCOP 1.59
  
• d1hv5a_ appears in SCOP 1.63
  
• d1hv5a_ appears in the current release, SCOPe 2.08