SCOPe 2.04: Domain d1hv1a_: 1hv1 A:

Lineage for d1hv1a_ (1hv1 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (18 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)

8. Domain d1hv1a_: 1hv1 A: [61286]

Details for d1hv1a_

PDB Entry: 1hv1, 1.8 Å

PDB Description: dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1hv1a_:

Sequence; same for both SEQRES and ATOM records:

>d1hv1a_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftaywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d1hv1a_:

• d1hv1a_ first appeared in SCOP 1.57
  
• d1hv1a_ appears in SCOPe 2.03
  
• d1hv1a_ appears in SCOPe 2.05
  
• d1hv1a_ appears in the current release, SCOPe 2.08