SCOP 1.75: Domain d1hv0a_: 1hv0 A:

Lineage for d1hv0a_ (1hv0 A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (17 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (10 PDB entries)

8. Domain d1hv0a_: 1hv0 A: [61285]
   mutant

Details for d1hv0a_

PDB Entry: 1hv0, 1.6 Å

PDB Description: dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOP Domain Sequences for d1hv0a_:

Sequence; same for both SEQRES and ATOM records:

>d1hv0a_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyfvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d1hv0a_:

• d1hv0a_ first appeared in SCOP 1.57
  
• d1hv0a_ appears in SCOP 1.73
  
• d1hv0a_ appears in SCOPe 2.01
  
• d1hv0a_ appears in the current release, SCOPe 2.08