Lineage for d1hv0a_ (1hv0 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 295061Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 295092Protein Xylanase II [49979] (15 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 295111Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries)
  8. 295116Domain d1hv0a_: 1hv0 A: [61285]
    mutant

Details for d1hv0a_

PDB Entry: 1hv0 (more details), 1.6 Å

PDB Description: dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase

SCOP Domain Sequences for d1hv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv0a_ b.29.1.11 (A:) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyfvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOP Domain Coordinates for d1hv0a_:

Click to download the PDB-style file with coordinates for d1hv0a_.
(The format of our PDB-style files is described here.)

Timeline for d1hv0a_: