SCOP 1.73: Domain d1huob1: 1huo B:10-91

Lineage for d1huob1 (1huo B:10-91)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)

8. Domain d1huob1: 1huo B:10-91 [61275]
   Other proteins in same PDB: d1huoa3, d1huoa4, d1huob3, d1huob4
   complexed with cr, tte

Details for d1huob1

PDB Entry: 1huo, 2.6 Å

PDB Description: crystal structure of dna polymerase beta complexed with dna and cr-tmppcp

PDB Compounds: (B:) DNA polymerase beta

SCOP Domain Sequences for d1huob1:

Sequence; same for both SEQRES and ATOM records:

>d1huob1 a.60.6.1 (B:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus) [TaxId: 10116]}
tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

Timeline for d1huob1:

• d1huob1 first appeared in SCOP 1.57
  
• d1huob1 appears in SCOP 1.71
  
• d1huob1 appears in SCOP 1.75
  
• d1huob1 appears in the current release, SCOPe 2.08